Streptococcus Suis ( S. Suis ) Vaccine
Abstract
A Streptococcus suis ( S. suis ) vaccine is provided. For the S. suis vaccine, an antigen is a protein with an amino acid sequence shown in SEQ ID NO: 2. A preparation method of the S. suis vaccine is provided, including the following steps: mixing a white oil and aluminum stearate to obtain a white oil adjuvant; adding poly sorbate 80 to an aqueous solution of the protein with the amino acid sequence shown in SEQ ID NO: 2, and thoroughly mixing to obtain an antigen solution; and mixing the antigen solution with the white oil adjuvant according to a volume ratio of (0.5-1.5):2, and emulsifying to obtain the S. suis vaccine. An animal immunized with the S. suis vaccine of the present disclosure can effectively resist the attack of S. suis serotype 2, 3, and 31, with a vaccine protection rate as high as 100%.
Claims (7)
1. A vaccine for Streptococcus suis ( S. suis ) comprising an isolated antigen and an effective amount of adjuvant, wherein lithe isolated antigen is a protein with the amino acid sequence shown in SEQ ID NO: 2, and the effective amount of adjuvant comprises a white oil.
Show 6 dependent claims
2. A preparation method of the vaccine for S. suis according to claim 1 , comprising the following steps: mixing white oil and aluminum stearate to obtain white oil adjuvant; adding polysorbate 80 to an aqueous solution of the protein with the amino acid sequence shown in SEQ ID NO: 2, and thoroughly mixing to obtain an isolated antigen solution; and mixing the isolated antigen solution with the white oil adjuvant according to a volume ratio of (0.5-1.5):2, and emulsifying to obtain the vaccine for S. suis.
3. The preparation method according to claim 2 , wherein the protein is obtained by inserting a coding gene for the protein into a vector, introducing the vector into a host strain, and inducing expression.
4. The preparation method according to claim 3 , wherein the coding gene for the protein has a sequence shown in SEQ ID NO: 1.
5. The preparation method according to claim 2 , wherein a mass ratio of the white oil to the aluminum stearate is (90-120):2.5.
6. The preparation method according to claim 5 , wherein the aqueous solution of the protein has a concentration of 0.9 mg/mL, to 1.2 mg/ml.
7. The preparation method according to claim 6 , wherein a volume of the polysorhate 80 is 2% to 6% of a volume of the aqueous solution of the protein.
Full Description
Show full text →
CROSS REFERENCE TO THE RELATED APPLICATIONS
This application is the national phase entry of International Application No. PCT/CN2022/098076, filed on Jun. 10, 2022, which is based upon and claims priority to Chinese Patent Application No. 202110752883.1, filed on Jul. 2, 2021, the entire contents of which are incorporated herein by reference.
SEQUENCE LISTING
The instant application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy is named GBHS011-PKG_Sequence_Listing.txt, created on Apr. 14, 2023, and is 14,001 bytes in size.
TECHNICAL FIELD
The present disclosure relates to the field of veterinary vaccines, and specifically to a Streptococcus suis ( S. suis ) vaccine.
BACKGROUND
S. suis is an important zoonotic pathogen that causes serious food safety problems, and years of antibiotic abuse has led to the emergence of drug resistance, which poses a challenge to the prevention and treatment of S. suis infection. However, researchers have immunized an animal with a whole-cell bacterial vaccine for S. suis, and immunization results show that the whole-cell inactivated vaccine can only provide a limited immunoprotection effect for S. suis of different serotypes.
In the prior art, there is a lack of a vaccine that can resist the attack of S. suis serotype 3 and 31, let alone a vaccine that can resist the attack of each of S. suis serotype 2, 3, and 31.
SUMMARY
An Objective of the present disclosure is to provide an S. suis vaccine that can resist the attack of each of S. suis serotypes 2, 3, and 31.
The objective of the present disclosure is achieved through the following technical solutions:
A S. suis vaccine is provided, where an antigen is a protein with an amino acid sequence shown in SEQ ID NO: 2.
In the present disclosure, an adjuvant in the S. suis vaccine is a white oil.
The present disclosure also provides a preparation method of the S. suis vaccine, including the following steps: mixing a white oil and aluminum stearate to obtain a white oil adjuvant; adding Tween-80 to an aqueous solution of the protein with the amino add sequence shown in SEQ ID NO: 2, and thoroughly mixing to obtain an antigen solution; and mixing the antigen solution with the white oil adjuvant according to a volume ratio of (0.5-1.5):2, and emulsifying to obtain the S. suis vaccine.
In the present disclosure, the protein is obtained by inserting a coding gene for the protein into a vector, introducing the vector into a host strain, and inducing expression.
In the present disclosure, the coding gene for the protein has a sequence shown in SEQ ID NO: 1.
In the present disclosure, a mass ratio of the white oil to the aluminum stearate is (90-120):2.5.
In the present disclosure, the aqueous solution of the protein has a concentration of 0.9 mg/mL to 1.2 mg/mL.
In the present disclosure, a volume of the Tween-SO is 2% to 6% of a volume of the aqueous solution of the protein.
The present disclosure has the following beneficial effects: An animal immunized with the S. suis vaccine of the present disclosure exhibits a protection rate as high as 100% against the attack of S. suis serotype 2, 3, and 31. As a versatile S. suis vaccine, the S. suis vaccine of the present disclosure can significantly reduce the production cost and vaccination workload, and can also reduce the stress response of an immunized animal.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 is an electrophoregram of polymerase chain reaction (PCR) amplification products of a protein A-coding gene and a control protein-coding gene, where Lane 1 to Lane 3 are for a PCR amplification product of the protein A-coding gene, a PCR amplification product of the control protein-coding gene, and a negative control, respectively; and M is for DL2000 DNA Marker.
FIG. 2 is an electrophoregram for digestion identification of recombinant plasmids, where Lane 1 and Lane 2 are for digestion products of a recombinant plasmid 1 and a control recombinant plasmid, respectively; M1 is for DL2000 DNA Marker; and M2 is for DL5000 DNA Marker.
FIG. 3 shows sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) results for induced expression of a protein A and a control protein, where Lane 1 to Lane 5 are for a control recombinant strain 3 (introduced with an empty vector pET-32a(+)), a lysate supernatant of a recombinant strain 2. a lysate precipitate suspension of the recombinant strain 2, a lysate supernatant of a control recombinant strain 2, and a lysate precipitate suspension of the control recombinant strain 2, respectively; and M is for a protein molecular weight marker (KDa).
FIG. 4 shows SDS-PAGE results of a purified protein A and a control protein, where Lane 1 to Lane 3 are for a purified protein expressed by a control recombinant strain 3, a protein A, and a control protein; and M is for a protein molecular weight marker (KDa).
FIGS. 5 A- 5 C show Western Blot (WB) results of a protein A and a control protein, where a primary antibody in FIG. 5 A is hyperimmune serum from a mouse immunized against S. suis serotype 2, a primary antibody in FIG. 5 B is hyperimmune serum from a mouse immunized against S. suis serotype 3, and a primary antibody in FIG. 5 C is hyperimmune serum from a mouse immunized against S. suis serotype 31; and lane 1 is for the protein A, lane 2 is for the control protein, and M is for a protein molecular weight marker (KDa).
FIG. 6 shows the serum antibody titer of mice, where the abscissa represents a number of days after the primary immunization and the ordinate represents an antibody titer; and the protein A and the control protein refer to a protein A vaccine-immunized group and a control protein vaccine-immunized group, respectively, and the virulent S. suis attack control refers to a virulent S. suis attack control group.
FIG. 7 shows the relative expression of IL-4 in spleens of mice in each group, where the protein A and the control protein refer to a protein A vaccine-immunized group and a control protein vaccine-immunized group, respectively, and the attack group refers to a virulent S. suis attack control group; and ** indicates P<0.01 compared with the virulent S. suis attack control group and *** indicates P<0.001 compared with the virulent S. suis attack control group.
FIG. 8 shows the relative expression of IFN-γ in spleens of mice in each group, where the protein A and the control protein refer to a protein A vaccine-immunized group and a control protein vaccine-immunized group, respectively, and the attack group refers to a virulent S. suis attack control group; and * indicates P<0.05 compared with the virulent S. suis attack control group and ** indicates P<0.01 compared with the virulent S. suis attack control group.
FIG. 9 shows the relative expression of TNF-α in spleens of mice in each group, where the protein A and the control protein refer to a protein A vaccine-immunized group and a control protein vaccine-immunized group, respectively, and the attack group refers to a virulent S. suis attack control group; and * indicates P<0.05 compared with the virulent S. suis attack control group and ns indicates P>0.05 compared with the virulent S. suis attack control group, without a significant difference.
DETAILED DESCRIPTION OF THE EMBODIMENTS
1. Experimental Animals
BALB/c female mice purchased from the Shanghai Lab Annual Research Center.
2. Main Reagents
Gel Extraction Kit and Plasmid Mini Kit I purchased from Omega; restriction endonucleases and T4 DNA ligase purchased from Takara Bio; isopropyl-β-D-thiogalactoside (IPTG) purchased from Sangon Biotech (Shanghai) Co., Ltd.; total RNA mini kit purchased from Guangzhou Magen Biotechnology Co., Ltd.; Ni-TED agarose purification resin purchased from BBI Life Sciences Corporation; and Hi Script II Q RT SuperMix for qPCR purchased from Nanjing Vazyme Biotech Co., Ltd.
3. Main Instruments
Spectrophotometer (model: Evolution 200) from Thermo Fisher Scientific; refrigerated thermostatic oscillator (model: THZ-C-L) from Taicang Johnson & Johnson Experimental Equipment Co., Ltd.; constant-temperature incubator (model: DNP-9272) from Shanghai Precision Experimental Equipment Co., Ltd.; PCR instrument (model: MastercyCler® nexus) from eppendoef; electrophoresis instrument (model: DYY-11) from Beijing Liuyi instrument Factory; automatic digital gel imaging instrument (model: Fallon 3500) and chemiluminescence instrument (model: Tanon 5200) from TIANGEN Biotech Co., Ltd.; ultrasonic cell disruptor (model: XO-1000D) from Nanjing Xianou Instruments Manufacture Co., Ltd.; semi-dry transfer cell (model: Trans-Blot SD 1703940) from Bio-Rad; and automatic microplate reader (model: ELx800) from BIO-TEK.
4. Reagent Preparation
Preparation of 100 mg/mL ampicillinum: 100 mg of an ampicillin antibiotic powder is dissolved in 1 mL of distilled water, and a resulting solution is filtered through a 0.22 μL filter and then stored at −20° C.
Binding buffer: 240 g of urea is added to 500 mL of 20 Mm phosphate buffered saline (PBS) at pH 7.4, and a resulting mixture is stirred for dissolution.
Coating solution: 1.59 g of Na 2 CO 3 , 2.93 g of NaHCO 3 , and 0.2 g of NaN 3 are dissolved in water, and a resulting solution is diluted to 1,000 mL with water, sealed, and stored at 4° C.
Washing solution (PBST): 8 g of NaCl, 0.2. g of KCl, 3.58 g of Na 2 HPO 4 .12H 2 O, 0.27 g of KH 2 PO 4 , and 0.5 mL of Tween-20 (polysorbate 20) are dissolved in water, and a resulting solution is diluted to 1,000 mL with water.
Blocking solution: Skimmed milk powder (SMP) is added at a final concentration of 5% (mass percentage concentration) to the washing solution (PBST), and a resulting mixture is thoroughly mixed.
Stop solution: A 2 M H 2 SO 4 aqueous solution is prepared.
EXAMPLE 1
Construction of a Recombinant Strain for Preparing a Vaccine Antigen
In order to find an effective antigen for a universal S. suis vaccine, a large number of antigens were screened by an immunoproteomics method, and it was finally found that a vaccine prepared with a protein A as an immunogen could resist the attack of S. suis serotype 2, 3, and 31. The protein A had a gene sequence shown in SEQ ID NO: 1 and an amino acid sequence shown in SEQ ID NO: 2.
1. PCR primers
Primers A-P1 and A-P2 were designed to amplify a coding gene for the protein A. In addition,
primers B-P1 and B-P2 were designed to amplify a coding gene for a control protein. The control protein had a gene sequence shown in SEQ ID NO: 3 and an amino acid sequence shown in SEQ ID NO: 4. Specific sequences of the primers were shown in Table 1, and the primers were synthesized by Nanjing GenScript Biotech Co., Ltd.
TABLE 1
Primer sequences
Annealin Enzymatic
Target Fragment temperature cleavage
sequence Primer sequence (5′→3′) size/bp (° C.) site
Protein A- A-P1:P1:CC GAATTC ATGAGTTCAGGCAAAATTACTCAGG 1407 63 EcoRV
coding (SEQ ID NO: 5)
gene A-P2:CCG CTCGAG GAATTTCATTTTAGCAGCTTTAGCG XhoI
(SEQ ID NO: 6)
Control B-P1:CC GAATTC ATGACAAAATTAAATCGTGTAGTAG 1236 60 EcoRV
protein- (SEQ ID NO: 7)
coding B-P2:CCG CTCGAG GGCCTCCCAACGTTTGAAAGCG XhoI
gene (SEQ ID NO: 8)
Note:
A marked horizontal line in Table 1 indicates an enzymatic cleavage site. 2. Extraction of DNA from S. suis
DNA was extracted from S. suis according to a conventional method.
3. PCR Amplification of Coding Genes for the Protein A and Control Protein
With DNA of S. suis serotype 3 JSHZ (published in the patent application No. 202011000342.5) as a template, primers of each target protein were used to amplify the protein A-coding gene and the control protein-coding gene through PCR, respectively. A PCR system was shown in Table 2.
TABLE 2
PCR system for the target gene
Reactant name Volume
Green Tap Mix 25 μL
Upstream primer 2 μL
Downstream primer 2 μL
S. suis DNA 1 μg
dd H 2 O Making up to 50 μL
A PCR amplification procedure was as follows: 95° C. for 3 min; 95° C. for 15 s; annealing temperature (protein A annealing temperature: 63° C., and control protein annealing temperature: for 15 s, and 72° C. for 90 s, with 35 cycles; and 72° C. for 5 min.
After a PCR procedure was completed, 8 μL of a PCR amplification product was taken and identified by 1% agarose gel electrophoresis.
The agarose gel electrophoresis identification results of PCR amplification products of the protein A-coding gene and the control protein-coding gene were shown in FIG. 1 . It can be seen from FIG. 1 that a specific target band appears at 1,407 bp for an amplification product of the protein A-coding gene, and a specific target band appears at 1,236 bp for an amplification product of the control protein-coding gene, each of which is of an expected size.
5. Recovery of Target Fragments
A GeL Extraction Kit from Omega was used to recover PCR amplification products for the protein A-coding gene and control protein-coding gene, respectively.
6. Digestion and Ligation of a Target Gene and a pET-32a(+) Vector
The recovered PCR amplification product for the protein A-coding gene and a pET-32a(+) vector each were subjected to double enzyme digestion with restriction endonucleases EcoRV and XhoI (an enzyme digestion system was shown in Table 3) at 37° C. for 1 h, a digestion product was taken and subjected to agarose electrophoresis, and a target fragment was recovered with a gel recovery kit. According to the ligation system in Table 4, T4 DNA Ligase and 10×T4 DNA Ligase Butler were added to DNA obtained after the double enzyme digestion and gel recovery of the protein A-coding gene and DNA obtained after the double enzyme digestion and gel recovery of the vector, and a resulting mixture was subjected to ligation at 16° C. for 2 h to obtain a recombinant plasmid 1 carrying the protein A-coding gene. In addition, a control recombinant plasmid carrying the control protein-coding gene was constructed according to the construction method of the recombinant plasmid 1 carrying the protein A-coding gene.
TABLE 3
Enzyme digestion system
Reagent Volume
Restriction endonuclease EcoRV 1 μL
Restriction endonuclease XhoI 1 μL
10 × Fast Green Buffer digestion buffer 2 μL
PCR amplification product of protein A 1 μg
or control protein-coding gene/vector
dd H 2 O Making up to 20 μL
TABLE 4
Ligation system
Reagent Volume
DNA obtained after the double enzyme digestion and gel 0.3 pmoL
recovery of a protein-coding gene
DNA obtained after the double enzyme digestion and gel 0.03 pmoL
recovery of the vector
T4 DNA Ligase 1 μL
10 × T4 DNA Ligase Buffer 2.5 μL
7. Transformation of a Ligation Product into a Trans 5α Chemical Competent Cell
The recombinant plasmid 1 and the control recombinant plasmid each were transformed into the Trans 5α chemical competent cell (purchased from TransGen Biotech Co., Ltd.), and specific steps were as follows:
•
• (1) The Trans 5α chemical competent cell was taken and thawed in ice. • (2) 2 μL of the recombinant plasmid was added to 50 μL of the Trans 5α chemical competent cell in an EP tube, a bottom of the EP tube was gently flicked with hands, and then the EP tube was allowed to stand in ice for 30 min, subjected to heat shock at 42° C. for 45 s, and immediately allowed to stand on ice for 2 min, and 700 μL of a non-resistant liquid LB medium was added, and the EP tube was incubated at 37° C. and 200 r/min under shaking for 1 h. • (3) The EP tube was centrifuged at 5,000 r/min for 3 min, 400 μL, of a resulting supernatant was discarded, and the EP tube was vortexed, and 100 μL of a resulting suspension was uniformly coated on an ampicillin-resistant LB solid medium and cultivated overnight at 37° C. 8. Identification of Positive Clones
Single colonies were picked from the LB solid medium obtained in section 7, inoculated into mL, of an ampicillin-resistant LB liquid medium, and cultivated at 37° C. and 200 r/min under shaking for 12 h to 16 h, and 1 μL of a resulting bacterial solution was taken for bacterial liquid PCR verification. A positive clone that had been successfully transformed with the recombinant plasmid 1 was named a recombinant strain 1. A positive clone that had been successfully transformed with the control recombinant plasmid was named a control recombinant strain 1.
9. Extraction of Plasmids
The recombinant plasmids in the recombinant strain 1 and the control recombinant strain 1 each were extracted with Plasmid Mini Kit I of Omega.
10. Digestion Identification of Recombinant Plasmids
The extracted recombinant plasmid 1 and control recombinant plasmid each were subjected to double enzyme digestion with restriction endonucleases EcoRV and XhoI, and after the digestion was completed, identification was conducted by agarose electrophoresis. Results were shown in FIG. 2 . A digestion product of the recombinant plasmid 1 had specific bands at 1,407 bp and 5,886 bp, and a digestion product of the control recombinant plasmid had specific bands at 1,236 bp and 5,886 bp, indicating that a corresponding target band was amplified for each of the exogenous gene and the pET-32a(+) vector. In addition, the correct insertion of the target gene was confirmed through genome sequencing.
11. Transformation of a Ligation Product into a Trans BL21(DE3)pLysS Chemical Competent Cell
The recombinant plasmid 1 and the control recombinant plasmid each were transformed into the Trans BL21(DE3)pLysS chemical competent cell (purchased from TransGen Biotech Co., Ltd.), and a specific method was as follows:
•
• (1) The Trans BL21(DE3)pLysS chemical competent cell was taken and thawed in ice. • (2) 2 μL of the recombinant plasmid was added to 50 μL of the Trans BL21(DE3)pLysS chemical competent cell in an EP tube, a bottom of the EP tube was gently flicked with hands, and then the EP tube was allowed to stand in ice for 30 min, subjected to heat shock at 42° C. for 45 s, and immediately allowed to stand on ice for 2 min; and 700 μL of a non-resistant liquid LB medium was added, and the EP tube was incubated at 37° C. and 200 r/min under shaking for 1 h. • (3) A bacterial solution obtained after the cultivation was centrifuged at 5,000 r/min for 3 min, 400 μL of a resulting supernatant was discarded, and the EP tube was vortexed; and 100 μL of a resulting suspension was uniformly coated on an ampicillin-resistant LB solid medium and cultivated overnight at 37° C. • (4) Single colonies were picked, inoculated into 5 mL of an ampicillin-resistant LB liquid medium, and cultivated at 37° C. and 200 r/min under shaking for 12 h to 16 h, and 1 μL of a resulting bacterial solution was taken for bacterial liquid PCR verification. Trans BL21(DE3)pLysS that had been successfully transformed with the recombinant plasmid 1 was named a recombinant strain 2. Trans BL2I(DE3)pLysS that had been successfully transformed with the control recombinant plasmid was named a control recombinant strain 2.
In addition, with reference to the same method as above, the pET-32a(+) vector was transformed into Trans BL21(DE3)pLysS to obtain a control recombinant strain 3.
II Protein Expression and Purification
1. Induced Expression
The recombinant strain 2, the control recombinant strain 2, and the control recombinant strain 3 each were subjected to induced expression. A specific method was as follows: A seed culture of the recombinant strain was added to an LB liquid medium with 100 mg/mL ampicillinum according to a volume ratio of 1:100, the strain was cultivated at 37° C. and 150 r/min until a resulting bacterial solution had an OD value of 0.4 to 0.6, then IPTG was added at a final concentration of 0.8 mmoL/L, and then induced expression was conducted in a shaking incubator at 16° C. and 150 r/min for 16 h; after the induced expression was completed, 4 mL of a resulting bacterial solution was taken and centrifuged at 12,000 r/min for 3 min, a resulting supernatant was discarded, resulting bacterial cells were washed with PBS 2 to 3 times, and 500 μL of PBS was added to resuspend the bacterial cells; a resulting bacterial suspension was subjected to ultrasonic disruption on ice until a clear solution was obtained, and after the ultrasonic disruption was completed, a resulting solution was centritliged at 12,000 r/min for 10 min; and a lysate supernatant and a lysate precipitate were collected separately, and the lysate precipitate was resuspended with Binding buffer to obtain a lysate precipitate suspension.
2. SDS-PAGE
48 μL of each of a lysate supernatant and a lysate precipitate suspension obtained after the induced expression of each strain in the previous step was taken and added to a new EP tube, then 12 μL of 5×SDS gel loading buffer was added, a resulting mixture was heated at 100° C. for 10 min, and 10 μL of a resulting reaction system was taken and subjected to SDS-PAGE. Results were shown in FIG. 3 . The protein A had a specific band at 70 KDa and the control protein had a specific band at 62 KDa; and both the protein A and the control protein were mainly expressed in the supernatant with a high expression level, that is, the two mainly underwent soluble expression.
3. Purification and WB of Proteins
The recombinant strain 2, the control recombinant strain 2, and the control recombinant strain 3 each were subjected to induced expression in accordance with the method in section 1 of part II (Protein expression and purification) in this example, and a lysate supernatant of each recombinant strain was collected, filtered through a 0.45 μm filter, and then purified by a Ni-TED agarose purification resin column of BBI Life Sciences Corporation to obtain a protein A, a control protein, and a protein expressed by the control recombinant strain 3. A specific purification method could be seen in instructions of the Ni-TED agarose purification resin column.
The purified protein A, control protein, and protein expressed by the control recombinant strain 3 each were detected by SDS-PAGE. Results were shown in FIG. 4 . The protein A had a specific band at 70 KDa and the control protein had a specific band at 62 KDa, both of which had no impurity band and had a high purity.
Moreover, the purified protein A and control protein each were transferred to an nitrocellulose (NC) membrane (purchased from GE in the United States) after the SDS-PAGE, and 5% SMP-containing PBST was added to block at room temperature for 2 h; hyperimmune serum obtained from a mouse immunized against each of S. suis serotype 2, 3, and 31 was added as a primary antibody, and a resulting mixture was incubated for 2 h at room temperature; sheep anti-mouse IgG labeled with horseradish peroxidase (HRP) was added as a secondary antibody, and a resulting mixture was incubated at room temperature for 1 h; and finally chromogenic exposure was conducted under an action of an enhanced chemiluminescence (ECL) solution. Results were shown in FIGS. 5 A- 5 C .
EXAMPLE 2
Immune Efficacy of Protein A
1. Active Immunization of Mice
The purified protein A was prepared into a vaccine as follows: 117.5 ml, of a white oil was mixed with 2.5 g of aluminum stearate, and a resulting mixture was vigorously shaken, autoclaved, cooled to about 50° C., and then vigorously shaken to obtain a white oil adjuvant in a transparent homogeneous state; an aqueous solution of the purified protein A in a concentration of 1.08 mg/mL was prepared, sterilized Tween-80 (polysorbate 80) was added in a volume 4% of a volume of the aqueous solution of the purified protein A, and a resulting mixture was thoroughly mixed to obtain an antigen solution; and the antigen solution was mixed with the white oil adjuvant according to a volume ratio of 1:2, and a resulting mixture was emulsified to obtain a protein A vaccine.
With the same method, a control protein was used instead of the protein A to prepare a corresponding vaccine, which was recorded as a control protein vaccine. An antigen concentration in the control protein vaccine was the same as an antigen concentration in the protein A vaccine.
A blank vaccine was prepared by the same method as the preparation method of the protein A vaccine, except that the same volume of PBS (concentration: 0.01 M, pH: 7.4) was used instead of the protein A.
4-week-old BALB/c female mice were randomly divided into 4 groups with 18 mice per group, including: 2 experimental groups (protein A vaccine-immunized group and control protein vaccine-immunized group), a blank vaccine control group, and a virulent S. suis attack control group. Each mouse in each experimental group was intraperitoneally injected with 200 μL of a corresponding vaccine that included 60 μg of an antigen protein; and each mouse in the control group was injected with 200 μL of the blank vaccine. 14 days after the primary immunization, mice in each group were subjected to secondary immunization by the same method as the primary immunization. Mice in the virulent S. suis attack control group were not immunized.
2. Immunoprotection of Mice from Virulent S. suis Attack
Mice in the protein A vaccine-immunized group, control protein vaccine-immunized group, and blank vaccine control group were subjected to virulent S. suis attack two weeks after the secondary immunization. Mice in each of the immunized groups and the control group were randomly divided into 3 groups with 5 mice per group, and the three groups were infected with S. suis serotype 2, 3, and 31, respectively; and mice in the virulent S. suis attack control group were randomly divided into 3 groups with 5 mice per group, and the 3 groups were infected with S. suis serotype 2, 3, and 31, respectively. After the mice were subjected to virulent S. suis attack, the mice were observed continuously for 7 d, during which the clinical symptoms and death of the mice were recorded. Results were shown in Table 5. After the virulent S. suis attack, the mice in the virulent S. suis attack control group showed obvious clinical symptoms such as mental malaise, messy coat, and gathering, where all of the mice attacked by S. suis serotype 2 and 3 died, and 4 of the mice attacked by S. suis 31 died. All of the mice attacked by S. suis serotype 2, 3, and 31 in the blank vaccine control group died. After the virulent S. suis attack, some of the mice in the experimental group showed symptoms such as messy coat, gathering, and mental malaise, but these symptoms disappeared within 48 h to 72 h. None of the mice in the protein A vaccine-immunized group that were attacked by S. suis serotype 2, 3, and 31 died, indicating a survival rate of 100%. None of the mice in the control protein vaccine-immunized group that were attacked by S. suis serotype 2 and 31 died, indicating a survival rate of 100%, but 2 of the mice in the control protein vaccine-immunized group that were attacked by S. suis serotype 3 died, indicating a survival rate of only 60%.
TABLE 5
Immunoprotection rate of each protein for mice
S. suis serotype 2 S. suis serotype 3 S. suis serotype 31
Grouping attack attack attack
Protein A vaccine- 100% (5/5) 100% (5/5) 100% (5/5)
immunized group
Control protein 100% (5/5) 60% (3/5) 100% (5/5)
vaccine-immunized
group
Blank vaccine control 0 (0/5) 0 (0/5) 0 (0/5)
group
Virulent S. suis attack 0 (0/5) 0 (0/5) 20% (1/5)
control group
Note:
The data in parentheses in Table 5 represent in the form of number of surviving mice/total number of attacked mice. 3. Enzyme-Linked Immunosorbent Assay (ELISA) Detection of Mouse Serum Antibody Titer
On day 14 and day 28 after the primary immunization of mice, 3 mice were randomly selected. from each group, blood was collected from the orbit, and serum was isolated through centrifugation and stored at −20° C. The serum antibody titer was determined by indirect ELISA.
A detection method of the mouse serum antibody titer for the protein A was specifically as follows: The coating solution was used to prepare the protein A into a solution with a concentration of 0.3135 μg/mL, and an ELISA plate was coated with the solution at 100 μL/well, incubated overnight at 4° C., and washed with the washing solution 3 times for 3 min each time; then 150 μL of the blocking solution was added to each well to block at 37° C. for 30 min, and the ELISA plate was washed with the washing solution; serum to be tested from a mouse in the protein A vaccine-immunized group was diluted 2-fold (dilution ratio: 1:400 to 1:6553600), 100 μL of a serum dilution was added to each well, and the ELISA plate was incubated at 37° C. for 1 h and then washed with the washing solution 3 times; sheep anti-mouse IgG-HRP (purchased from Beijing TransGen Biotech Co., Ltd., Item No. HS201-01) was diluted by 1:4000, 100 μL of a resulting dilution was added to each well, and the ELISA plate was incubated at 37° C. for 1 h and then washed with the washing solution 3 times; 100 μL of a TMB chromogenic solution (purchased from Huzhou InnoReagents Co., Ltd., Item No. TMB-S-001) was added to each well, and a reaction was allowed for 15 min in the dark; and 50 μL of the stop solution was added to each well, and the OD 450 was determined on a microplate reader. The antibody titer was calculated by a conventional method.
A detection method of the mouse serum antibody titer for the control protein was specifically as follows: The coating solution was used to prepare the control protein into a solution with a concentration of 5 μg/mL, and an ELISA plate was coated with the solution at 100 μL/well, incubated overnight at 4° C., and washed with the washing solution 3 times for 3 min each time; then 150 μL of the blocking solution was added to each well to block at 37° C. for 30 min, and the ELISA plate was washed with the washing solution; serum to be tested from a mouse in the control protein vaccine-immunized group was diluted 2-fold (dilution ratio: 1:400 to 1:6553600), 100 μL of a serum dilution was added to each well, and the ELISA plate was incubated at 37° C. for 1 h and then washed with the washing solution 3 times; sheep anti-mouse IgG-HRP (purchased from Beijing TransGen Biotech Co., Ltd., Item No. HS201-01) labeled with HRP was diluted by 1:4000, 100 of a resulting dilution was added to each well, and the ELISA plate was incubated at 3 7 ° C. for 1 h and then washed with the washing solution 3 times; 100 μL, of a TMB chromogenic solution (purchased from Huzhou InnoReagents Co., Ltd. ; Item No. TMB-S-001) was added to each well, and a reaction was allowed for 15 min in the dark; and 50 μL of the stop solution was added to each well, and the OD 450 was determined on a microplate reader. The antibody titer was calculated by a conventional method.
Results were shown in FIG. 6 . In the mice of the protein A vaccine-immunized group and the control protein vaccine-immunized group, a specific antibody could be detected with a high antibody level 14 days after the secondary immunization.
6. Detection of Expression Levels of Relevant Cytokines by Real-Time Quantitative Reverse Transcription-PCR (qRT-PCR)
(1) Extraction of RNA from the Spleen
14 days after the secondary immunization, 3 mice were randomly selected from each group, and RNA was extracted from the spleen of mice in each group with HiPure Total RNA Mini Kit of Magen.
(2) Reverse Transcription of RNA into cDNA
A HiScript II RT SuperMix for qPCR, (+gDNA wiper) reagent of Vazyme was used to reverse-transcribe each RNA in step (1) into cDNA. A specific method was as follows: According to Table 6, a mixed solution was prepared in an RNase-free centrifuge tube, gently pipetted up and down for thorough mixing, and placed at 42° C. for 2 min. Then, 4 μL of 5× HiScript II RT SuperMix for qPCR was added, a resulting mixture was gently pipetted up and down for thorough mixing, and then a reverse transcription reaction was conducted according to the procedure in Table 7 to obtain cDNA.
TABLE 6
Reverse transcription reaction system
Reagent Volume
Template RNA 1 pg~1 μg
4 × gDNA wiper Mix 4 μL
RNase-free ddH 2 O Making up to 16 μL
TABLE 7
Reverse transcription reaction procedure
Temperature Time
50° C. 15 min
85° C. 5 s
(3) Detection of Cytokines by qRT-PCR
With spleen cDNA of mice in each group obtained in step (2) as a template, amplification primers for cytokines IL-4, IFN-γ, and TNF-α (Table 8) and a SYBR-Green-PCR kit were used to conduct qRT-PCR, and an expression level of a cytokine in the spleen of mice in each group relative to an internal reference gene GAPDH mRNA was detected by fluorescence quantification. With a GAPDH gene as an internal reference gene, the 2 −ΔΔ Ct method was used to compare the experimental group and the virulent S. suis attack control group. Due to the addition of a fluorophore to a PCR system, a change of a fluorescence signal was used to detect a change of an amount of each cyclic amplification product in the PCR amplification in real time, and a starting template was subjected to quantitative analysis through a Ct value and a standard curve.
According to Table 9, a qPCR system was prepared, and the fluorescence quantitative PCR amplification was conducted according to the following procedure: predenaturation at 95° C. for 30 s; 95° C. for 10 s and 60° C. for 30 s, with 40 cycles; and 95° C. for 15 s, 95° C. for 60 s, and 95° C. for 15 s. The cytokines IL-4, IFN-γ, and TNF-α and the GAPDH gene primers were synthesized by Nanjing GenScript Biotech Co., Ltd., as shown in Table 8.
TABLE 8
Cytokine primer sequences
Annealing
Target Primer sequence Fragment temperature
fragment (from 5′ end to 3′ end) size/bp (° C.)
GAPDH P1: TGGCCTTCCGTGTTCCTAC 1011 60
(SEQ ID NO: 9)
P2: TGAAGTCGCAGGAGACAACC (SEQ ID
NO: 10)
TNF-α P1: GAGTGACAAGCCTGTAGCCC (SEQ ID 1457 59
NO: 11)
P2: GACAAGGTACAACCCATCGG (SEQ ID
NO: 12)
IFN-γ P1: AGCGGCTGACTGAACTCAGATTGTAG 242 58
(SEQ ID NO: 13)
P2: GTCACAGTTTTCAGCTGTATAGGG
(SEQ ID NO: 14)
IL-4 P1: CGAAGAACACCACAGAGAGTGAGC 180 58
(SEQ ID NO: 15)
P2: GACTCATTCATGGTGCAGCTTATC
(SEQ ID NO: 16)
TABLE 9
qPCR system
Reactant Volume
2 × ChamQ Universal SYBR Qrcr Master Mix 10 μL
Forward primer 0.4 μL
Reverse primer 0.4 μL
cDNA 2 μL
ddH 2 O Making up to 20 μL
As shown in FIG. 7 , an expression level of IL-4 in the spleen of mice of the control protein vaccine-immunized group has an extremely significant difference (P<0.01) from that of the virulent S. suis attack control group, and an expression level of IL-4 in the spleen of mice of the protein A vaccine-immunized group has a significant difference (P<0.05) from that of the virulent S. suis attack control group.
As shown in FIG. 8 , 14 days after the secondary immunization, a relative expression level of IFN-γ in the spleen of mice of each of the protein A vaccine-immunized group and the control protein vaccine-immunized group is significantly different from that of the virulent S. suis attack control group (P<0.05).
As shown in FIG. 9 , 14 days after the secondary immunization, a relative expression level of INF-α in the spleen of mice of the protein A vaccine-immunized group is significantly different from that of the virulent S. suis attack control group (P<0.05), and a relative expression level of TNF-α in the spleen of mice of the control protein vaccine-immunized group is not significantly different from that of the virulent S. suis attack control group (P>0.05).
It can be seen from the above experiments that, after the mice immunized with the vaccines are attacked by S. suis serotype 2, 3, and 31, the protein A vaccine and the control protein vaccine can significantly increase a IgG antibody level in serum of mice; the protein A vaccine exhibits a protection rate of 100% against each of S. suis serotype 2, 3, and 31; and the control protein vaccine exhibits a protection rate of 100% only against S. suis serotype 2 and 31 and exhibits a protection rate only of 60% against S. suis serotype 3, that is, the control protein vaccine cannot effective resist the attack of S. suis serotype 3.
Protein A gene sequence
(SEQ ID NO: 1)
ATGAGTTCAGGCAAAATTACTCAGGTTGTCGGACCAGTTGTAGACGTTGCGTTTG
CAGCAGAAGATAAACTTCCTGAGATTAACAACGCACTCGTTGTATATAAAAATGATGA
TTCCAAACAAAAAGTCGTGCTTGAAGTGGCTTTGGAACTTGGTGATGGCGTTGTACG
GACCATTGCCATGGAATCAACGGATGGATTGACACGTGGGATGGAAGTTCTCGATAC
AGGTCGTCCTATCTCAGTTCCAGTCGGTAAAGAAACCTTGGGTCGTGTCTTCAATGTG
TTGGGAGATACCATTGACCTTGAAGAGTCTTTTCCGGCAGATTTTGAACGTGAGCCTA
TCCATAAGAAAGCGCCAGCTTTTGACGAATTATCTACTTCAAGCGAAATTTTGGAAAC
AGGGATTAAGGTTATCGACCTCCTAGCACCTTATCTAAAAGGTGGTAAGGTTGGTCTC
TTCGGTGGTGCCGGTGTTGGTAAAACCGTTCTTATCCAAGAATTGATTCACAATATTG
CCCAAGAACACGGTGGTATCTCTGTGTTTACCGGAGTTGGCGAGCGTACCCGTGAAG
GGAACGATCTTTACTGGGAAATGAAAGAATCAGGTGTTATTGAAAAAACGGCCATGG
TATTTGGTCAGATGAATGAGCCACCAGGAGCCCGTATGCGGGTTGCTCTTACTGGTTT
GACCATTGCGGAATACTTCCGTGATGTGGAAGGGCAGGATGTTCTTCTGTTCATCGAC
AATATCTTCCGTTTCACTCAGGCTGGTTCAGAAGTGTCTGCCCTCTTGGGCCGTATGC
CATCAGCCGTTGGTTATCAGCCAACACTTGCAACTGAGATGGGACAATTGCAGGAGC
GTATTACCTCAACCAAGAAGGGTTCTGTTACATCTATTCAGGCTATTTACGTACCTGCA
GATGACTATACAGACCCAGCTCCAGCGACAGCTTTCGCTCACTTGGACTCGACTACC
AACTTGGAACGTAAGTTGACTCAGCTTGGTATCTACCCTGCGGTGGATCCGTTGGCGT
CATCATCTCGTGCGCTTTCTCCACAAATTGTTGGTGAAGAGCACTATACAGTGGCTAT
GGAAGTAAAACGTGTTCTTCAACGTTACCAAGAATTGCAAGATATTATTGCCATTCTC
GGTATGGATGAATTATCAGATGAAGAGAAGACCTTGGTTGGTCGCGCTCGTCGTATCC
AATTCTTCCTCTCTCAAAACTTCAACGTTGCGGAGCAATTTACAGGTATGCCAGGTTC
TTATGTGCCAGTAGCAGAAACGGTGAAAGGCTTTAAGGAAATCTTGGACGGCAAACA
CGACCATCTACCAGAAGATGCCTTCCGAAATGTTGGTTCAATTGAGGATGTGGTCGCT
AAAGCTGCTAAAATGAAATTCTAG
Protein A amino acid sequence:
(SEQ ID NO: 2)
MSSGKITQVVGPVVDVAFAAEDKLPEINNALVVYKNDDSKQKVVLEVALELGDGV
VRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEESFPADFEREPIH
KKAPAFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHG
GISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYF
RDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGS
VTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQLGIYPAVDPLASSSRALAPQIVGE
EHYAVAMEVKRVLQRYQELQDIIAILGMDELSDEEKTLVGRARRIOFFLSQNFNVAEQFT
GMPGSYVPVAETVKGFKEILDGKHDHLPEDAFRNVGSIEDVVAKAAKMKF
Control protein gene sequence:
(SEQ ID NO: 3)
ATGACAAAATTAAATCGTGTAGTAGTAACAGGCTACGGTCTGACATCTCCAATCG
GAAATACGCCAGAGGAGTTCTGGAATAGTTTGAAGGCTGGGAAAATTGGGATCGGAA
AGATTACCAAGTTTGATACCAGTGAATATTCGGTCCATAATGCCGCGGAATTAAAAGA
TTTTCCTTTTGACAAATATTTCGTTAAAAAGGATACAAATCGCTACGATAATTACTCGC
TCTATGCACTCTATGCAGCTAAAGAAGCGATTGCTAATGCACAGCTGGATACAGAGAC
AGTGGATAGTGACCGTTTTGGCGTTATCTTATCAACAGGTATCGGTGGTATTTTGGAAA
TTGAAGAGCAAGTGGCTCGGATGAACGAAAAAGGTCCAAAACGCATTCGTCCCATG
GCTCTTCCAAAAGCTCTTCCAAATATGGCGGCCGGAAATATTGCCATGCAGGTCGGTG
CCAATGGTGTCTGCAAGTGTGTTATCACAGCCTGTGCTTCGTCAAATGATGCTTTAGG
GGAAGCCTTCCGTGAAATCAAGTTTGGTTTCCAAGATGTGATGCTGGCTGGCGGAGC
AGAGGCAGCCATTACTCCCTTTGCTATCGGTGGTTTCCAGGCTTTGACAGCTATGTCG
ACTACTGAGGATCCAGAACGTGCGTCTATTCCATTTGACAAGGACCGCAATGGTTTTG
TCATGGGAGAGGGTTCCGCGGTTTTAGTATTGGAAAGTTTGGAACACGCAGAGGCGC
GTGGAGCGACGATTTTGGCTGAAATCGTTGGTTATGGAAATACCTGCGATGCTTACCA
CATGACTTCTCCACATCCAGAAGGTCTGGGTGCTATTAAGGCCATGAAGTTGGCCATT
TCAGAAGCAGGTTTAGAGCCAGCTGATATTGATTACATCAATGCCCATGGCACTTCGA
CACCGGCTAATGAAAAAGGGGAAAGCCAAGCTATCGTATCTGTCTTCGGCAAGAACA
CGCCAGTTTCTTCTACCAAGTCCTTCACTGGTCACTTGTTGGGTGCAGCGGGTGCCGT
TGAAGCGGCAGCTGTCATTGAGGCTATGCGTCATTCTTACGCACCAAAGACAGCTGG
TACGACAGAATTATCTGAAGATATTGAAGCGGATGTCATTTATGGACAGGGGCGTGAT
ATGGAAATCCGCCATGCCATTTCAAATACATTTGGCTTTGGTGGGCATAATTCAGTCAT
CGCTTTCAAACGTTGGGAGGCCTAA
Control protein amino acid sequence:
(SEQ ID NO: 4)
MTKLNRVVVTGYGLTSPIGNTPEEFWNSLKAGKIGIGKITKFDTSEYSVHNAAELKD
FPFDKYFVKKDTNRYDNYSLYALYAAKEAIANAQLDTETVDSDRFGVILSTGIGGILEIEE
QVARMNEKGPKRIRPMALPKALPNMAAGNIAMQVGANGVCKCVITACASSNDALGEA
FREIKFGFQDVMLAGGAEAAITPFAIGGFQALTAMSTTEDPERASIPFDKDRNGFVMGEG
SAVLVLESLEHAEARGATILAEIVGYGNTCDAYHMTSPHPEGLGAIKAMKLAISEAGLEP
ADIDYINAHGTSTPANEKGESQAIVSVFGKNTPVSSTKSFTGHLLGAAGAVEAAAVIEAM
RHSYAPKTAGTTELSEDIEADVIYGQGRDMEIRHAISNTFGFGGHNSVIAFKRWEA
Citations
This patent cites (11)
- US20190336594
- US20210015910
- US101613399
- US104248754
- US108671227
- US109180822
- US112063561
- US112409495
- US112410310
- US113332421
- US2018162428